Lineage for d6i5ma3 (6i5m A:321-415)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2386873Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386874Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2386981Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2386982Protein automated matches [254425] (17 species)
    not a true protein
  7. 2387037Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries)
  8. 3061927Domain d6i5ma3: 6i5m A:321-415 [361989]
    Other proteins in same PDB: d6i5ma1, d6i5ma2
    automated match to d4m53a3
    protein/RNA complex; complexed with fmt, gdp, mg, na

Details for d6i5ma3

PDB Entry: 6i5m (more details), 2.4 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6i5ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5ma3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d6i5ma3:

Click to download the PDB-style file with coordinates for d6i5ma3.
(The format of our PDB-style files is described here.)

Timeline for d6i5ma3:

  • d6i5ma3 appears in periodic updates to SCOPe 2.07 starting on 2019-01-02