Lineage for d6i5ma1 (6i5m A:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868719Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries)
  8. 2868722Domain d6i5ma1: 6i5m A:2-206 [361987]
    Other proteins in same PDB: d6i5ma2, d6i5ma3
    automated match to d2qn6a3
    protein/RNA complex; complexed with fmt, gdp, mg, na

Details for d6i5ma1

PDB Entry: 6i5m (more details), 2.4 Å

PDB Description: gamma subunit of the translation initiation factor 2 from sulfolobus solfataricus in complex with gdp and formate ion
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d6i5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5ma1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

SCOPe Domain Coordinates for d6i5ma1:

Click to download the PDB-style file with coordinates for d6i5ma1.
(The format of our PDB-style files is described here.)

Timeline for d6i5ma1: