Lineage for d6m9ka_ (6m9k A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460131Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 2460132Protein lambda exonuclease [53018] (1 species)
  7. 2460133Species Bacteriophage lambda [TaxId:10710] [53019] (4 PDB entries)
  8. 3061922Domain d6m9ka_: 6m9k A: [361984]
    automated match to d1avqa_
    complexed with so4

Details for d6m9ka_

PDB Entry: 6m9k (more details), 2.3 Å

PDB Description: crystal structure of lambda exonuclease in complex with the red beta c-terminal domain
PDB Compounds: (A:) Exonuclease

SCOPe Domain Sequences for d6m9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m9ka_ c.52.1.13 (A:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
mtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfht
llaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdg
lcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmk
reglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d6m9ka_:

Click to download the PDB-style file with coordinates for d6m9ka_.
(The format of our PDB-style files is described here.)

Timeline for d6m9ka_:

  • d6m9ka_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02