SCOPe 2.07: Domain d5z2aa2: 5z2a A:159-310

Lineage for d5z2aa2 (5z2a A:159-310)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Bacillus sp. [TaxId:36824] [312567] (14 PDB entries)

8. Domain d5z2aa2: 5z2a A:159-310 [361980]
   automated match to d1j2ga2
   complexed with aza, cl, edo, oxy, so4

Details for d5z2aa2

PDB Entry: 5z2a, 1.72 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 86% rh.

PDB Compounds: (A:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5z2aa2:

Sequence; same for both SEQRES and ATOM records:

>d5z2aa2 d.96.1.4 (A:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtq

Timeline for d5z2aa2:

• d5z2aa2 is new in SCOPe 2.07-stable
  
• d5z2aa2 does not appear in SCOPe 2.08