Lineage for d6nfta_ (6nft A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588714Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 2588721Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)
  7. 2588722Species Human (Homo sapiens) [TaxId:9606] [161208] (5 PDB entries)
    Uniprot P45974 169-285
  8. 3061909Domain d6nfta_: 6nft A: [361971]
    automated match to d2g45a_
    complexed with edo, kkg, unx, zn

Details for d6nfta_

PDB Entry: 6nft (more details), 1.65 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with (4-oxoquinazolin-3(4h)-yl)acetic acid
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d6nfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfta_ g.44.1.5 (A:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
gevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggn
nhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

SCOPe Domain Coordinates for d6nfta_:

Click to download the PDB-style file with coordinates for d6nfta_.
(The format of our PDB-style files is described here.)

Timeline for d6nfta_:

  • d6nfta_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02