Lineage for d5z65a4 (5z65 A:634-963)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333294Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2333295Protein automated matches [190220] (14 species)
    not a true protein
  7. 2333397Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries)
  8. 3061906Domain d5z65a4: 5z65 A:634-963 [361968]
    Other proteins in same PDB: d5z65a1, d5z65a2, d5z65a3
    automated match to d4fkea4
    complexed with nag, zn

Details for d5z65a4

PDB Entry: 5z65 (more details), 2.65 Å

PDB Description: crystal structure of porcine aminopeptidase n ectodomain in functional form
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d5z65a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z65a4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq
aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina
istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql
qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla
wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra
leqalektkanikwvkenkevvlnwfiehs

SCOPe Domain Coordinates for d5z65a4:

Click to download the PDB-style file with coordinates for d5z65a4.
(The format of our PDB-style files is described here.)

Timeline for d5z65a4:

  • d5z65a4 appears in periodic updates to SCOPe 2.07 starting on 2019-01-02