Lineage for d5z65a3 (5z65 A:545-633)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2363428Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2363450Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2363451Protein automated matches [254707] (4 species)
    not a true protein
  7. 2363485Species Pig (Sus scrofa) [TaxId:9823] [311379] (18 PDB entries)
  8. 3061905Domain d5z65a3: 5z65 A:545-633 [361967]
    Other proteins in same PDB: d5z65a1, d5z65a2, d5z65a4
    automated match to d4fkea3
    complexed with nag, zn

Details for d5z65a3

PDB Entry: 5z65 (more details), 2.65 Å

PDB Description: crystal structure of porcine aminopeptidase n ectodomain in functional form
PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d5z65a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z65a3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllninvtgyfqvnyde

SCOPe Domain Coordinates for d5z65a3:

Click to download the PDB-style file with coordinates for d5z65a3.
(The format of our PDB-style files is described here.)

Timeline for d5z65a3:

  • d5z65a3 appears in periodic updates to SCOPe 2.07 starting on 2019-01-02