SCOPe 2.07: Domain d5z65a1: 5z65 A:64-282

Lineage for d5z65a1 (5z65 A:64-282)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [311377] (18 PDB entries)

8. Domain d5z65a1: 5z65 A:64-282 [361965]
   Other proteins in same PDB: d5z65a2, d5z65a3, d5z65a4
   automated match to d4fkea1
   complexed with nag, zn

Details for d5z65a1

PDB Entry: 5z65, 2.65 Å

PDB Description: crystal structure of porcine aminopeptidase n ectodomain in functional form

PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d5z65a1:

Sequence; same for both SEQRES and ATOM records:

>d5z65a1 b.98.1.0 (A:64-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
skpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihskkl
nyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
mppkgsstplaedpnwsvtefettpvmstyllayivsef

Timeline for d5z65a1:

• d5z65a1 is new in SCOPe 2.07-stable
  
• d5z65a1 appears in the current release, SCOPe 2.08