Lineage for d5ziqc1 (5ziq C:37-190)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302461Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302462Protein automated matches [190590] (22 species)
    not a true protein
  7. 3061886Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries)
  8. 3061901Domain d5ziqc1: 5ziq C:37-190 [361963]
    Other proteins in same PDB: d5ziqa2, d5ziqb2, d5ziqc2
    automated match to d1hbra_
    complexed with edo, hem, so4

Details for d5ziqc1

PDB Entry: 5ziq (more details), 1.5 Å

PDB Description: crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at ph 4
PDB Compounds: (C:) Globin protein

SCOPe Domain Sequences for d5ziqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ziqc1 a.1.1.0 (C:37-190) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
dprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrn
desfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfa
lqttladaytenmeriykiwiswttekiregfre

SCOPe Domain Coordinates for d5ziqc1:

Click to download the PDB-style file with coordinates for d5ziqc1.
(The format of our PDB-style files is described here.)

Timeline for d5ziqc1:

  • d5ziqc1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-02