Lineage for d5yw1i_ (5yw1 I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2584197Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2584198Protein automated matches [190829] (11 species)
    not a true protein
  7. 2584204Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries)
  8. 3061897Domain d5yw1i_: 5yw1 I: [361959]
    automated match to d4bnri_

Details for d5yw1i_

PDB Entry: 5yw1 (more details), 2.6 Å

PDB Description: crystal structure of full length ns3 protein (ed4ns2bns3) in complex with bovine pancreatic trypsin inhibitor
PDB Compounds: (I:) PTI protein

SCOPe Domain Sequences for d5yw1i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yw1i_ g.8.1.0 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckarmiryfynakaglcqpfvyggcrakrnnfkssedcmrtc

SCOPe Domain Coordinates for d5yw1i_:

Click to download the PDB-style file with coordinates for d5yw1i_.
(The format of our PDB-style files is described here.)

Timeline for d5yw1i_:

  • d5yw1i_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02