Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries) |
Domain d5zm9d_: 5zm9 D: [361950] automated match to d1hbra_ complexed with cl, hem |
PDB Entry: 5zm9 (more details), 2.7 Å
SCOPe Domain Sequences for d5zm9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zm9d_ a.1.1.0 (D:) automated matches {Ramazzottius varieornatus [TaxId: 947166]} dprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrn desfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfa lqttladaytenmeriykiwiswttekiregfre
Timeline for d5zm9d_: