![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (22 species) not a true protein |
![]() | Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries) |
![]() | Domain d5ziqd_: 5ziq D: [361949] Other proteins in same PDB: d5ziqa2, d5ziqb2, d5ziqc2 automated match to d1hbra_ complexed with edo, hem, so4 |
PDB Entry: 5ziq (more details), 1.5 Å
SCOPe Domain Sequences for d5ziqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ziqd_ a.1.1.0 (D:) automated matches {Ramazzottius varieornatus [TaxId: 947166]} rfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrnde sfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfalq ttladaytenmeriykiwiswttekiregfre
Timeline for d5ziqd_: