Lineage for d5z2va_ (5z2v A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574645Fold e.49: Recombination protein RecR [111303] (1 superfamily)
    consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)
  4. 2574646Superfamily e.49.1: Recombination protein RecR [111304] (2 families) (S)
  5. 3061877Family e.49.1.0: automated matches [361939] (1 protein)
    not a true family
  6. 3061878Protein automated matches [361940] (1 species)
    not a true protein
  7. 3061879Species Pseudomonas aeruginosa [TaxId:208964] [361941] (1 PDB entry)
  8. 3061880Domain d5z2va_: 5z2v A: [361942]
    automated match to d1vdda_
    complexed with gol, n, na, po4, zn

Details for d5z2va_

PDB Entry: 5z2v (more details), 2.2 Å

PDB Description: crystal structure of recr from pseudomonas aeruginosa pao1
PDB Compounds: (A:) recombination protein recr

SCOPe Domain Sequences for d5z2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2va_ e.49.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
fsplirqlieslrilpgvgqksaqrmalmllerdrsgglklaqaltaamegvghcrqcrt
lseeelcpqcadprrddsllcvvegpldvfaveqtgyrgryfvlkghlspldglgpeaig
ipelearirdgafsevilatnptvegeatahyiaqllagrgltlsriahgvplggelelv
dggtlahalagrrpi

SCOPe Domain Coordinates for d5z2va_:

Click to download the PDB-style file with coordinates for d5z2va_.
(The format of our PDB-style files is described here.)

Timeline for d5z2va_:

  • d5z2va_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02