Lineage for d6nfeb2 (6nfe B:163-305)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467648Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2467649Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2468152Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2468153Protein automated matches [190891] (36 species)
    not a true protein
  7. 3061862Species Legionella pneumophila [TaxId:446] [361924] (1 PDB entry)
  8. 3061865Domain d6nfeb2: 6nfe B:163-305 [361927]
    automated match to d1dkra2
    complexed with adp, amp, edo, eoh, hsx

Details for d6nfeb2

PDB Entry: 6nfe (more details), 1.75 Å

PDB Description: crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d6nfeb2:

Sequence, based on SEQRES records: (download)

>d6nfeb2 c.61.1.0 (B:163-305) automated matches {Legionella pneumophila [TaxId: 446]}
nimivspdvggvvraravakrlndaelsiidkrrsgpnksevmhiigepanknciivddi
vdtagtlctaahelkkngaksvrayithpvlsgpavnnikhsgldevvvtdtiplsaeaq
ncekirvvsladmlaqaikrvnv

Sequence, based on observed residues (ATOM records): (download)

>d6nfeb2 c.61.1.0 (B:163-305) automated matches {Legionella pneumophila [TaxId: 446]}
nimivspdvggvvraravakrlndaelsiidkrrsevmhiigepanknciivddivdtag
tlctaahelkkngaksvrayithpvlsgpavnnikhsgldevvvtdtiplsaeaqnceki
rvvsladmlaqaikrvnv

SCOPe Domain Coordinates for d6nfeb2:

Click to download the PDB-style file with coordinates for d6nfeb2.
(The format of our PDB-style files is described here.)

Timeline for d6nfeb2:

  • d6nfeb2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-02

View in 3D
Domains from same chain:
(mouse over for more information)
d6nfeb1