Lineage for d6izhb_ (6izh B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525290Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2525291Protein automated matches [190935] (17 species)
    not a true protein
  7. 3061851Species Pseudomonas sp [TaxId:306] [361913] (1 PDB entry)
  8. 3061854Domain d6izhb_: 6izh B: [361916]
    automated match to d1qu9a_
    complexed with mg

Details for d6izhb_

PDB Entry: 6izh (more details), 1.75 Å

PDB Description: crystal structure of deaminase amne from pseudomonas sp. ap-3
PDB Compounds: (B:) 2-aminomuconate deaminase

SCOPe Domain Sequences for d6izhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6izhb_ d.79.1.0 (B:) automated matches {Pseudomonas sp [TaxId: 306]}
saklvegkakpmgsfphvkragdflfvsgtssrrpdntfvgaepddtgrprpnielqtre
visnirdilqsvgadlgdvvevcsylvnmndfaaynkvyaeffdatgparttvavhqlph
pqlvieikvvaykpl

SCOPe Domain Coordinates for d6izhb_:

Click to download the PDB-style file with coordinates for d6izhb_.
(The format of our PDB-style files is described here.)

Timeline for d6izhb_:

  • d6izhb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02