Lineage for d6i8nb_ (6i8n B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307379Species Lactococcus lactis [TaxId:416870] [188710] (6 PDB entries)
  8. 3061849Domain d6i8nb_: 6i8n B: [361911]
    automated match to d3f8fa_
    complexed with hox, mpo

Details for d6i8nb_

PDB Entry: 6i8n (more details), 1.79 Å

PDB Description: crystal structure of lmrr with v15 replaced by unnatural amino acid 4- amino-l-phenylalanine
PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d6i8nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i8nb_ a.4.5.0 (B:) automated matches {Lactococcus lactis [TaxId: 416870]}
aeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdg
iissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseai

SCOPe Domain Coordinates for d6i8nb_:

Click to download the PDB-style file with coordinates for d6i8nb_.
(The format of our PDB-style files is described here.)

Timeline for d6i8nb_:

  • d6i8nb_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-02