SCOPe 2.07: Domain d5z0fa1: 5z0f A:1-273

Lineage for d5z0fa1 (5z0f A:1-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (3 species)
   not a true protein

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [361811] (10 PDB entries)

8. Domain d5z0fa1: 5z0f A:1-273 [361893]
   Other proteins in same PDB: d5z0fa2, d5z0fb_
   automated match to d4hd7a_
   complexed with cu, no3, per

Details for d5z0fa1

PDB Entry: 5z0f, 1.16 Å

PDB Description: crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 10 min at 298 k

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d5z0fa1:

Sequence; same for both SEQRES and ATOM records:

>d5z0fa1 a.86.1.0 (A:1-273) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
mtvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsfl
pwhrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpf
aastgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnh
legwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptgg
tpdvvdlnetmkpwntvrpadlldhtayytfda

Timeline for d5z0fa1:

• d5z0fa1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27