SCOP 1.63: Domain d1baoc_: 1bao C:

Lineage for d1baoc_ (1bao C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)

8. Domain d1baoc_: 1bao C: [36189]
   complexed with zn; mutant

Details for d1baoc_

PDB Entry: 1bao, 2.2 Å

PDB Description: the contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants

SCOP Domain Sequences for d1baoc_:

Sequence; same for both SEQRES and ATOM records:

>d1baoc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinftsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1baoc_:

• d1baoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1baoc_ appears in SCOP 1.61
  
• d1baoc_ appears in SCOP 1.65
  
• d1baoc_ appears in the current release, SCOPe 2.08