Lineage for d5ysoc_ (5yso C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (167 PDB entries)
  8. 3061822Domain d5ysoc_: 5yso C: [361884]
    automated match to d2zasa_
    complexed with 90c

Details for d5ysoc_

PDB Entry: 5yso (more details), 2.5 Å

PDB Description: crystal structure of estrogen related receptor-3 (err-gamma) ligand binding domain with dn200434
PDB Compounds: (C:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d5ysoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysoc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyni

SCOPe Domain Coordinates for d5ysoc_:

Click to download the PDB-style file with coordinates for d5ysoc_.
(The format of our PDB-style files is described here.)

Timeline for d5ysoc_:

  • d5ysoc_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27