Lineage for d5ysob_ (5yso B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (161 PDB entries)
  8. 3061821Domain d5ysob_: 5yso B: [361883]
    automated match to d2zasa_
    complexed with 90c

Details for d5ysob_

PDB Entry: 5yso (more details), 2.5 Å

PDB Description: crystal structure of estrogen related receptor-3 (err-gamma) ligand binding domain with dn200434
PDB Compounds: (B:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d5ysob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysob_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea

SCOPe Domain Coordinates for d5ysob_:

Click to download the PDB-style file with coordinates for d5ysob_.
(The format of our PDB-style files is described here.)

Timeline for d5ysob_:

  • d5ysob_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27