Lineage for d5y41b_ (5y41 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335562Protein Orphan nuclear receptor NURR1 [89142] (1 species)
  7. 2335563Species Human (Homo sapiens) [TaxId:9606] [89143] (2 PDB entries)
  8. 3061810Domain d5y41b_: 5y41 B: [361872]
    automated match to d1ovle_
    complexed with cl, mg, peg, pge, rpg

Details for d5y41b_

PDB Entry: 5y41 (more details), 2.05 Å

PDB Description: crystal structure of ligand-bound nurr1-lbd
PDB Compounds: (B:) Nuclear receptor subfamily 4 group A member 2

SCOPe Domain Sequences for d5y41b_:

Sequence, based on SEQRES records: (download)

>d5y41b_ a.123.1.1 (B:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqanpdyqmsgddtqhiqqfydlltgsmeiirg
waekipgfadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgf
gewidsivefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhv
tfnngglnrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

Sequence, based on observed residues (ATOM records): (download)

>d5y41b_ a.123.1.1 (B:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]}
ppvslisalvrahvdsnpamtsldysrfqanpdtqhiqqfydlltgsmeiirgwaekipg
fadlpkadqdllfesaflelfvlrlayrsnpvegklifcngvvlhrlqcvrgfgewidsi
vefssnlqnmnidisafsciaalamvterhglkepkrveelqnkivnclkdhvtfnnggl
nrpnylskllgklpelrtlctqglqrifylkledlvpppaiidklfldtlpf

SCOPe Domain Coordinates for d5y41b_:

Click to download the PDB-style file with coordinates for d5y41b_.
(The format of our PDB-style files is described here.)

Timeline for d5y41b_:

  • d5y41b_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27