Lineage for d5zcda2 (5zcd A:476-555)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (37 species)
    not a true protein
  7. 3061753Species Bacillus sp. [TaxId:1409] [361815] (4 PDB entries)
  8. 3061802Domain d5zcda2: 5zcd A:476-555 [361864]
    Other proteins in same PDB: d5zcda1
    automated match to d2ze0a2
    complexed with ca, mlr

Details for d5zcda2

PDB Entry: 5zcd (more details), 1.71 Å

PDB Description: crystal structure of alpha-glucosidase in complex with maltotriose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcda2:

Sequence, based on SEQRES records: (download)

>d5zcda2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpsessftnievlihnypldk
netleqctlhpyetrvylis

Sequence, based on observed residues (ATOM records): (download)

>d5zcda2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpssftnievlihnypldkne
tleqctlhpyetrvylis

SCOPe Domain Coordinates for d5zcda2:

Click to download the PDB-style file with coordinates for d5zcda2.
(The format of our PDB-style files is described here.)

Timeline for d5zcda2:

  • d5zcda2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcda1