Lineage for d5zcba1 (5zcb A:4-475)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (103 species)
    not a true protein
  7. 3056808Species Bacillus sp. [TaxId:1409] [356870] (6 PDB entries)
  8. 3061783Domain d5zcba1: 5zcb A:4-475 [361845]
    Other proteins in same PDB: d5zcba2
    automated match to d2ze0a1
    complexed with ca

Details for d5zcba1

PDB Entry: 5zcb (more details), 2.5 Å

PDB Description: crystal structure of alpha-glucosidase
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcba1:

Sequence, based on SEQRES records: (download)

>d5zcba1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgeangvtsdsadewvaedggnfnmifqfehmglwdkgeekpldlielkt
iltnwqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyq
gqelgmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnte
knagfstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

Sequence, based on observed residues (ATOM records): (download)

>d5zcba1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgeangvtsdsadewvaedggnfnmifqfehmglwdkpldlielktiltn
wqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyqgqel
gmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnteknag
fstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

SCOPe Domain Coordinates for d5zcba1:

Click to download the PDB-style file with coordinates for d5zcba1.
(The format of our PDB-style files is described here.)

Timeline for d5zcba1:

  • d5zcba1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcba2