![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein automated matches [190060] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) |
![]() | Domain d6nddo_: 6ndd O: [361836] Other proteins in same PDB: d6ndda_, d6nddb_, d6nddd_, d6ndde_, d6nddg_, d6nddh_, d6nddj_, d6nddk_, d6nddm_, d6nddn_, d6nddp_, d6nddq_ automated match to d1aoxb_ complexed with cl, mn, na, nh4, so4 |
PDB Entry: 6ndd (more details), 3.05 Å
SCOPe Domain Sequences for d6nddo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nddo_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall ekagtlgeqif
Timeline for d6nddo_: