Lineage for d5zbnc_ (5zbn C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2415254Protein automated matches [190228] (20 species)
    not a true protein
  7. 3061757Species Nicotiana benthamiana [TaxId:4100] [361819] (2 PDB entries)
  8. 3061758Domain d5zbnc_: 5zbn C: [361820]
    automated match to d1gyla_
    complexed with po4

Details for d5zbnc_

PDB Entry: 5zbn (more details), 2.32 Å

PDB Description: structure of glycolate oxidase without fmn from nicotiana benthamiana
PDB Compounds: (C:) glycolate oxidase

SCOPe Domain Sequences for d5zbnc_:

Sequence, based on SEQRES records: (download)

>d5zbnc_ c.1.4.1 (C:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
vtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidmst
tvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgpg
irffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltlkn
fegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarlav
qagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalga
sgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd

Sequence, based on observed residues (ATOM records): (download)

>d5zbnc_ c.1.4.1 (C:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
vtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidmst
tvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgpg
irffqlyvykdrnvvaqlvrraeragfkaialtvdtprlvlppfltlknfeglasyvagq
idrtlswkdvqwlqtitslpilvkgvltaedarlavqagaagiivsnhgarqldyvpsti
maleevvkaaqgripvfldggvrrgtdvfkalalgasgifigrpvvfslaaegeagikkv
lqmlrdefeltmalsgcrslneitrnhivtewd

SCOPe Domain Coordinates for d5zbnc_:

Click to download the PDB-style file with coordinates for d5zbnc_.
(The format of our PDB-style files is described here.)

Timeline for d5zbnc_:

  • d5zbnc_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27