Lineage for d6ndai_ (6nda I:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468413Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2468414Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2468415Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2468566Protein automated matches [190060] (2 species)
    not a true protein
  7. 2468569Species Human (Homo sapiens) [TaxId:9606] [186779] (16 PDB entries)
  8. 3061755Domain d6ndai_: 6nda I: [361817]
    Other proteins in same PDB: d6ndaa_, d6ndab_, d6ndad_, d6ndae_, d6ndag_, d6ndah_, d6ndaj_, d6ndak_, d6ndam_, d6ndan_, d6ndap_, d6ndaq_
    automated match to d1aoxb_
    complexed with cd, cl, na, nh4, so4

Details for d6ndai_

PDB Entry: 6nda (more details), 3.15 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain and cadmium
PDB Compounds: (I:) Integrin alpha-2

SCOPe Domain Sequences for d6ndai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndai_ c.62.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d6ndai_:

Click to download the PDB-style file with coordinates for d6ndai_.
(The format of our PDB-style files is described here.)

Timeline for d6ndai_:

  • d6ndai_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27