Lineage for d5zcea1 (5zce A:4-475)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (104 species)
    not a true protein
  7. 3056808Species Bacillus sp. [TaxId:1409] [356870] (6 PDB entries)
  8. 3061752Domain d5zcea1: 5zce A:4-475 [361814]
    Other proteins in same PDB: d5zcea2
    automated match to d2ze0a1
    complexed with ca, mtt

Details for d5zcea1

PDB Entry: 5zce (more details), 1.56 Å

PDB Description: crystal structure of alpha-glucosidase in complex with maltotetraose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcea1:

Sequence, based on SEQRES records: (download)

>d5zcea1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgqangvtsdsadewvaedggnfnmifqfehmglwdkgeekpldlielkt
iltnwqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyq
gqelgmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnte
knagfstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

Sequence, based on observed residues (ATOM records): (download)

>d5zcea1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgqangvtsdsadewvaedggnfnmifqfehmglwkpldlielktiltnw
qnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyqgqelg
mtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnteknagf
stgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

SCOPe Domain Coordinates for d5zcea1:

Click to download the PDB-style file with coordinates for d5zcea1.
(The format of our PDB-style files is described here.)

Timeline for d5zcea1:

  • d5zcea1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcea2