Lineage for d6nfda_ (6nfd A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 3061747Species Klebsiella pneumoniae [TaxId:484021] [361809] (1 PDB entry)
  8. 3061748Domain d6nfda_: 6nfd A: [361810]
    automated match to d4jpma_
    complexed with edo, po4

Details for d6nfda_

PDB Entry: 6nfd (more details), 1.17 Å

PDB Description: beta-lactamase shv-11 from klebsiella pneumoniae strain ntuh-k2044
PDB Compounds: (A:) beta-lactamase SHV-11

SCOPe Domain Sequences for d6nfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfda_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
naspqpleqikqresqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlar
vdagdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvg
gpagltallrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsars
qrqllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviyl
rdtpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d6nfda_:

Click to download the PDB-style file with coordinates for d6nfda_.
(The format of our PDB-style files is described here.)

Timeline for d6nfda_:

  • d6nfda_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27