Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Ethr repressor [109978] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
Domain d6hoea2: 6hoe A:98-214 [361803] Other proteins in same PDB: d6hoea1 automated match to d5nima2 protein/DNA complex; complexed with gh2 |
PDB Entry: 6hoe (more details), 1.9 Å
SCOPe Domain Sequences for d6hoea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hoea2 a.121.1.1 (A:98-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} drenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaer drgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d6hoea2: