SCOPe 2.08: Domain d6i9ib1: 6i9i B:2-108

Lineage for d6i9ib1 (6i9i B:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d6i9ib1: 6i9i B:2-108 [361784]
   automated match to d1ad0a1

Details for d6i9ib1

PDB Entry: 6i9i, 1.98 Å

PDB Description: rift valley fever virus gn in complex with a neutralizing antibody fragment

PDB Compounds: (B:) RV-Gn1 Light chain

SCOPe Domain Sequences for d6i9ib1:

Sequence; same for both SEQRES and ATOM records:

>d6i9ib1 b.1.1.0 (B:2-108) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgmtqtpspvsaavggtvtincqasqsvynnyllswyqqkpgqppkrliysastlasgvs
srfkgsgsgtqftltisdvqcddaatyyclgsydgnsadclafgggtevvvkg

Timeline for d6i9ib1:

• d6i9ib1 first appeared in SCOPe 2.07