Lineage for d6ndrb1 (6ndr B:1-187)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (28 species)
    not a true protein
  7. 3061702Species Legionella pneumophila [TaxId:272624] [361764] (1 PDB entry)
  8. 3061703Domain d6ndrb1: 6ndr B:1-187 [361765]
    Other proteins in same PDB: d6ndra2, d6ndrb2
    automated match to d2ixka_
    complexed with edo, so4, tdo

Details for d6ndrb1

PDB Entry: 6ndr (more details), 1.6 Å

PDB Description: crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l- rhamnose
PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d6ndrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndrb1 b.82.1.0 (B:1-187) automated matches {Legionella pneumophila [TaxId: 272624]}
mniintqidelkiiepkiygdergffyesfqakryeellgitdrfvqdnfsrsqkgvlrg
lhyqsqqtqgklvsvlagevfdvavdirlgsptfgqwvgvilsgenkrqfwipkgfahgf
yvlsamadfaykctdyyhpesefsihyldpqlaidwplgeqvqlspkdaaakllnlidae
llpryqa

SCOPe Domain Coordinates for d6ndrb1:

Click to download the PDB-style file with coordinates for d6ndrb1.
(The format of our PDB-style files is described here.)

Timeline for d6ndrb1:

  • d6ndrb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6ndrb2