Class a: All alpha proteins [46456] (290 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein automated matches [191131] (3 species) not a true protein |
Species Hepatitis b virus ayw/france/tiollais/1979 [TaxId:490133] [361673] (1 PDB entry) |
Domain d6htxc_: 6htx C: [361758] automated match to d4bmga_ |
PDB Entry: 6htx (more details), 2.66 Å
SCOPe Domain Sequences for d6htxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6htxc_ a.62.1.1 (C:) automated matches {Hepatitis b virus ayw/france/tiollais/1979 [TaxId: 490133]} mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail cwgelmtlatwvgvnledpasrdlvvsyvntnmglkfrqllwfhiscltfgretvieylv sfgvwirtppayrppnapilstlpet
Timeline for d6htxc_: