![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (23 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [189718] (60 PDB entries) |
![]() | Domain d5o2fb1: 5o2f B:29-270 [361745] Other proteins in same PDB: d5o2fa2, d5o2fb2 automated match to d5zh1b_ complexed with cl, edo, so4, zn, zz7 |
PDB Entry: 5o2f (more details), 2.01 Å
SCOPe Domain Sequences for d5o2fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o2fb1 d.157.1.0 (B:29-270) automated matches {Klebsiella pneumoniae [TaxId: 573]} geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk lr
Timeline for d5o2fb1: