Lineage for d6ndib_ (6ndi B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485265Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2485266Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2485563Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2485564Protein automated matches [190646] (74 species)
    not a true protein
  7. 3061667Species Klebsiella pneumoniae [TaxId:72407] [361729] (1 PDB entry)
  8. 3061668Domain d6ndib_: 6ndi B: [361730]
    automated match to d2nzug_

Details for d6ndib_

PDB Entry: 6ndi (more details), 2.6 Å

PDB Description: 2.60 angstrom resolution crystal structure of periplasmic binding and sugar binding domain of laci family protein from klebsiella pneumoniae.
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d6ndib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndib_ c.93.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
pstigvlaldtvttpfsveitlsieetarahgwnsfvvnmfsddrpeavvdlllshrpdg
iifttmglrqvplpeklltlpcvlanceslsqpvasyipddeqgqydavkallaagyrrp
lclhlpasqpatirrrrgleracreagiepdhlshsymgqgdehyhdipavvlahiregk
pgfdsvicgndriafmvyqtllgqglripqdvavvgydnmvgigdlflpplstvqlphyd
igrlsalhiihgdnhretrkvaspwlprash

SCOPe Domain Coordinates for d6ndib_:

Click to download the PDB-style file with coordinates for d6ndib_.
(The format of our PDB-style files is described here.)

Timeline for d6ndib_:

  • d6ndib_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from other chains:
(mouse over for more information)
d6ndia_