Lineage for d6ncrb1 (6ncr B:1-345)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (57 species)
    not a true protein
  7. 3061658Species Chlamydia trachomatis [TaxId:272561] [361720] (1 PDB entry)
  8. 3061660Domain d6ncrb1: 6ncr B:1-345 [361722]
    Other proteins in same PDB: d6ncrb2
    automated match to d5v0ib_
    complexed with act, ca, edo, trp

Details for d6ncrb1

PDB Entry: 6ncr (more details), 1.75 Å

PDB Description: crystal structure of tryptophan-trna ligase from chlamydia trachomatis with bound l-tryptophan
PDB Compounds: (B:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d6ncrb1:

Sequence, based on SEQRES records: (download)

>d6ncrb1 c.26.1.0 (B:1-345) automated matches {Chlamydia trachomatis [TaxId: 272561]}
mkkkrvltgdrptgklhlghwigsimnrlqlqndsrydcffiiadlhtlttktrkeeilq
idnhiydvladwlsvgidpeksaiylqsaipeiyelnlifsmltplnhimgipsikemar
naslneeslshgligypvlqsadillakahlvpvgkdneahveltrdiaktfnrlygevf
pepdilqgeltalvgtngqgkmsksannaiylsddaktvqekirklytdpnrihattpgr
vegnplfiyhdlfnphkeeveefktryrqgcirdvevkarlaeeinlflnpfrekrselv
aqpkfleealqqgtekmrtvaretmeevhdhlglsrkwrtilass

Sequence, based on observed residues (ATOM records): (download)

>d6ncrb1 c.26.1.0 (B:1-345) automated matches {Chlamydia trachomatis [TaxId: 272561]}
mkkkrvltgdrptgklhlghwigsimnrlqlqndsrydcffiiadlhtlttktrkeeilq
idnhiydvladwlsvgidpeksaiylqsaipeiyelnlifsmltplnhimgipsikemar
naslneeslshgligypvlqsadillakahlvpvgneahveltrdiaktfnrlygevfpe
pdilqalvgtngqgkmsksannaiylsddaktvqekirklytdpnrihattpgrvegnpl
fiyhdlfnphkeeveefktryrqgcirdvevkarlaeeinlflnpfrekrselvaqpkfl
eealqqgtekmrtvaretmeevhdhlglsrkwrtilass

SCOPe Domain Coordinates for d6ncrb1:

Click to download the PDB-style file with coordinates for d6ncrb1.
(The format of our PDB-style files is described here.)

Timeline for d6ncrb1:

  • d6ncrb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6ncrb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ncra_