Lineage for d6iyea1 (6iye A:1-193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889301Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)
  8. 2889324Domain d6iyea1: 6iye A:1-193 [361711]
    Other proteins in same PDB: d6iyea2
    automated match to d4qaja_

Details for d6iyea1

PDB Entry: 6iye (more details), 1.55 Å

PDB Description: crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii with 12% peg 1500 at 1.55 a resolution.
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d6iyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iyea1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d6iyea1:

Click to download the PDB-style file with coordinates for d6iyea1.
(The format of our PDB-style files is described here.)

Timeline for d6iyea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iyea2