Lineage for d6hoaa2 (6hoa A:95-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334734Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2334735Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2334736Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2334743Protein Ethr repressor [109978] (2 species)
  7. 2334744Species Mycobacterium tuberculosis [TaxId:1773] [109979] (63 PDB entries)
    Uniprot P96222 22-215
  8. 3061639Domain d6hoaa2: 6hoa A:95-214 [361701]
    Other proteins in same PDB: d6hoaa1
    automated match to d5nima2
    protein/DNA complex; complexed with ggn, gol

Details for d6hoaa2

PDB Entry: 6hoa (more details), 1.5 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44830
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6hoaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hoaa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d6hoaa2:

Click to download the PDB-style file with coordinates for d6hoaa2.
(The format of our PDB-style files is described here.)

Timeline for d6hoaa2:

  • d6hoaa2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6hoaa1