Lineage for d6hhea_ (6hhe A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2321013Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2321104Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2321105Protein automated matches [191085] (8 species)
    not a true protein
  7. 3061635Species Ceratitis capitata [TaxId:7213] [361697] (1 PDB entry)
  8. 3061636Domain d6hhea_: 6hhe A: [361698]
    automated match to d4pt1b_
    complexed with pg0, so4

Details for d6hhea_

PDB Entry: 6hhe (more details), 1.52 Å

PDB Description: crystal structure of the medfly odorant binding protein ccapobp22/ccapobp69a
PDB Compounds: (A:) Odorant binding protein OBP69a

SCOPe Domain Sequences for d6hhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hhea_ a.39.2.0 (A:) automated matches {Ceratitis capitata [TaxId: 7213]}
sgakkltnlciketgvtedlfieaqetgkmpnnqrlkcfihcvldkiglidadnivhldn
lleilppefvpiveelhttcgtqsgadgcetaflttecyiktnpvilkllfttfse

SCOPe Domain Coordinates for d6hhea_:

Click to download the PDB-style file with coordinates for d6hhea_.
(The format of our PDB-style files is described here.)

Timeline for d6hhea_:

  • d6hhea_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27