![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.38: MFS general substrate transporter [103472] (1 superfamily) 12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar |
![]() | Superfamily f.38.1: MFS general substrate transporter [103473] (4 families) ![]() |
![]() | Family f.38.1.0: automated matches [354001] (1 protein) not a true family |
![]() | Protein automated matches [354002] (1 species) not a true protein |
![]() | Species Staphylococcus hominis [TaxId:1290] [354003] (4 PDB entries) |
![]() | Domain d6hzpa_: 6hzp A: [361696] automated match to d4ikva_ complexed with fvt |
PDB Entry: 6hzp (more details), 2.5 Å
SCOPe Domain Sequences for d6hzpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hzpa_ f.38.1.0 (A:) automated matches {Staphylococcus hominis [TaxId: 1290]} qtiqsipqkgffghprglgvlffvefwerfsyygmramlifymyfaihqnglgidkttam simsvygaliymssipgawiadritgtrgatllgavliiighiclslpfalfglfssmff iiigsglmkpnisnivgrlypendtridagfvifymsvnlgalispiilqhfvdirnfhg gfllaaigmalglvwyllfnrknlgsvgmkptnplskeekrkygmiigiivaivivvllv tyythtlsfdlisntvlvlgvalpiiyfttmlrskdvtdgersrvkafiplfilgmlfws iqeqgsnvlniyglersdmqlnlfgwttrfgealfqsinplfillfapvismiwlkmgkk qpslaikfsigtllaglsyiliglvglgyghtqfsvnwvilsyvicvigelclsptgnsa avklapkafnaqmmsvwlltnasaqaingtlvklikplgqtnyfiflgtvaivitliilv fspkitk
Timeline for d6hzpa_: