Lineage for d6hzpa_ (6hzp A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580524Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 2580525Superfamily f.38.1: MFS general substrate transporter [103473] (4 families) (S)
  5. 3053939Family f.38.1.0: automated matches [354001] (1 protein)
    not a true family
  6. 3053940Protein automated matches [354002] (1 species)
    not a true protein
  7. 3053941Species Staphylococcus hominis [TaxId:1290] [354003] (4 PDB entries)
  8. 3061634Domain d6hzpa_: 6hzp A: [361696]
    automated match to d4ikva_
    complexed with fvt

Details for d6hzpa_

PDB Entry: 6hzp (more details), 2.5 Å

PDB Description: crystal structure of a pot family transporter in complex with 5- aminolevulinic acid
PDB Compounds: (A:) Peptide ABC transporter permease

SCOPe Domain Sequences for d6hzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hzpa_ f.38.1.0 (A:) automated matches {Staphylococcus hominis [TaxId: 1290]}
qtiqsipqkgffghprglgvlffvefwerfsyygmramlifymyfaihqnglgidkttam
simsvygaliymssipgawiadritgtrgatllgavliiighiclslpfalfglfssmff
iiigsglmkpnisnivgrlypendtridagfvifymsvnlgalispiilqhfvdirnfhg
gfllaaigmalglvwyllfnrknlgsvgmkptnplskeekrkygmiigiivaivivvllv
tyythtlsfdlisntvlvlgvalpiiyfttmlrskdvtdgersrvkafiplfilgmlfws
iqeqgsnvlniyglersdmqlnlfgwttrfgealfqsinplfillfapvismiwlkmgkk
qpslaikfsigtllaglsyiliglvglgyghtqfsvnwvilsyvicvigelclsptgnsa
avklapkafnaqmmsvwlltnasaqaingtlvklikplgqtnyfiflgtvaivitliilv
fspkitk

SCOPe Domain Coordinates for d6hzpa_:

Click to download the PDB-style file with coordinates for d6hzpa_.
(The format of our PDB-style files is described here.)

Timeline for d6hzpa_:

  • d6hzpa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27