SCOPe 2.07: Domain d6hoba1: 6hob A:24-94

Lineage for d6hoba1 (6hob A:24-94)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83331] [313822] (25 PDB entries)

8. Domain d6hoba1: 6hob A:24-94 [361675]
   Other proteins in same PDB: d6hoba2
   automated match to d5nima1
   protein/DNA complex; complexed with gj5

Details for d6hoba1

PDB Entry: 6hob, 1.8 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44831

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6hoba1:

Sequence; same for both SEQRES and ATOM records:

>d6hoba1 a.4.1.0 (A:24-94) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaenp

Timeline for d6hoba1:

• d6hoba1 is new in SCOPe 2.07-stable
  
• d6hoba1 appears in the current release, SCOPe 2.08