Lineage for d6f93a_ (6f93 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (134 species)
    not a true protein
  7. 2472558Species Helicobacter pylori [TaxId:85962] [188666] (6 PDB entries)
  8. 3061608Domain d6f93a_: 6f93 A: [361670]
    automated match to d5vc2b_

Details for d6f93a_

PDB Entry: 6f93 (more details), 2.8 Å

PDB Description: helicobacter pylori serine hydroxymethyl transferase in apo form
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6f93a_:

Sequence, based on SEQRES records: (download)

>d6f93a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
fleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyaegypnkryyg
gcevvdkieslaierakklfncqfanvqahsgsqannavyhallkpydkilgmdlscggh
lthgakvsltgkhyqsfsygvnldgyidyeealkiaqsvkpeiivcgfsaypreidfkkf
reiadevgalllgdiahvaglvvtgehahpfphchvvsstthktlrgprggiiltndeei
aakidkaifpgtqggplmhviaakavgfkenlkpefkayaqlvksnmqvlakalkeknhk
lvsggtsnhlllmdfldkpysgkdadialgnagitvnkntipgetrspfvtsgirigsaa
lsargmgakefeiignkisdilndinnvslqlhvkeelkamvnqfpvy

Sequence, based on observed residues (ATOM records): (download)

>d6f93a_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
fleqtdseifelifeeykrqnehlemiasenytfasvmeamgsvltnkyvvdkieslaie
rakklfncqfanvqahsgsqannavyhallkpydkilgmdlscgghsltgkhyqsfsygv
nldgyidyeealkiaqsvkpeiivcgfsaypreidfkkfreiadevgalllgdiahvagl
vvtgehahpfphchvvsstthktlrgprggiiltndeeiaakidkaifpgtqggplmhvi
aakavgfkenlkpefkayaqlvksnmqvlakalkeknhklvsggtsnhlllmdfldkpys
gkdadialgnagitvnkntipgetrspfvtsgirigsaalsargmgakefeiignkisdi
lndinnvslqlhvkeelkamvnqfpvy

SCOPe Domain Coordinates for d6f93a_:

Click to download the PDB-style file with coordinates for d6f93a_.
(The format of our PDB-style files is described here.)

Timeline for d6f93a_:

  • d6f93a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from other chains:
(mouse over for more information)
d6f93b_