Lineage for d6ho0a1 (6ho0 A:24-93)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304932Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2304939Protein Ethr repressor [109651] (2 species)
  7. 2304940Species Mycobacterium tuberculosis [TaxId:1773] [109652] (32 PDB entries)
    Uniprot P96222 22-215
  8. 3061603Domain d6ho0a1: 6ho0 A:24-93 [361665]
    Other proteins in same PDB: d6ho0a2
    automated match to d5nima1
    protein/DNA complex; complexed with gfk

Details for d6ho0a1

PDB Entry: 6ho0 (more details), 1.9 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm41325
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6ho0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ho0a1 a.4.1.9 (A:24-93) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

SCOPe Domain Coordinates for d6ho0a1:

Click to download the PDB-style file with coordinates for d6ho0a1.
(The format of our PDB-style files is described here.)

Timeline for d6ho0a1:

  • d6ho0a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6ho0a2