Lineage for d6fs2a1 (6fs2 A:174-325)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575433Protein automated matches [190236] (3 species)
    not a true protein
  7. 2575434Species Human (Homo sapiens) [TaxId:9606] [188722] (50 PDB entries)
  8. 3061601Domain d6fs2a1: 6fs2 A:174-325 [361663]
    Other proteins in same PDB: d6fs2a2, d6fs2b2
    automated match to d2kbwa_
    complexed with e4k

Details for d6fs2a1

PDB Entry: 6fs2 (more details), 2.55 Å

PDB Description: mcl1 in complex with indole acid ligand
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d6fs2a1:

Sequence, based on SEQRES records: (download)

>d6fs2a1 f.1.4.1 (A:174-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdtkplgeagaagrraletlrrvgdgvqrnhetafqgmlr
kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes
itdvlvrtkrdwlvkqrgwdgfveffhvedle

Sequence, based on observed residues (ATOM records): (download)

>d6fs2a1 f.1.4.1 (A:174-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdplgeagaagrraletlrrvgdgvqrnhetafqgmlrkl
dikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesit
dvlvrtkrdwlvkqrgwdgfveffhvedle

SCOPe Domain Coordinates for d6fs2a1:

Click to download the PDB-style file with coordinates for d6fs2a1.
(The format of our PDB-style files is described here.)

Timeline for d6fs2a1:

  • d6fs2a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6fs2a2