Lineage for d6fs0l2 (6fs0 L:111-216)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)
  8. 3061600Domain d6fs0l2: 6fs0 L:111-216 [361662]
    Other proteins in same PDB: d6fs0a1, d6fs0a2
    automated match to d5mesl2
    complexed with e4w

Details for d6fs0l2

PDB Entry: 6fs0 (more details), 2.25 Å

PDB Description: induced myeloid leukemia cell differentiation protein fabcomplex in complex with azd5991
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6fs0l2:

Sequence, based on SEQRES records: (download)

>d6fs0l2 b.1.1.0 (L:111-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvthexxghtvekslsraa

Sequence, based on observed residues (ATOM records): (download)

>d6fs0l2 b.1.1.0 (L:111-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsraa

SCOPe Domain Coordinates for d6fs0l2:

Click to download the PDB-style file with coordinates for d6fs0l2.
(The format of our PDB-style files is described here.)

Timeline for d6fs0l2:

  • d6fs0l2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6fs0l1