SCOPe 2.08: Domain d6bkcl2: 6bkc L:107-213

Lineage for d6bkcl2 (6bkc L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6bkcl2: 6bkc L:107-213 [361653]
   Other proteins in same PDB: d6bkch_, d6bkcl1
   automated match to d1dn0a2
   complexed with nag

Details for d6bkcl2

PDB Entry: 6bkc, 2.6 Å

PDB Description: structure of hepatitis c virus envelope glycoprotein e2 core from genotype 6a bound to broadly neutralizing antibody ar3b

PDB Compounds: (L:) Fab AR3B light chain

SCOPe Domain Sequences for d6bkcl2:

Sequence; same for both SEQRES and ATOM records:

>d6bkcl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6bkcl2:

• d6bkcl2 first appeared in SCOPe 2.07