Lineage for d6fs1a1 (6fs1 A:174-321)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575410Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)
  7. 2575411Species Human (Homo sapiens) [TaxId:9606] [188549] (5 PDB entries)
  8. 3061590Domain d6fs1a1: 6fs1 A:174-321 [361652]
    Other proteins in same PDB: d6fs1a2, d6fs1b2
    automated match to d3d7va_
    complexed with e4q, edo

Details for d6fs1a1

PDB Entry: 6fs1 (more details), 1.6 Å

PDB Description: mcl1 in complex with an indole acid ligand
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d6fs1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fs1a1 f.1.4.1 (A:174-321) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgmlr
kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes
itdvlvrtkrdwlvkqrgwdgfveffhv

SCOPe Domain Coordinates for d6fs1a1:

Click to download the PDB-style file with coordinates for d6fs1a1.
(The format of our PDB-style files is described here.)

Timeline for d6fs1a1:

  • d6fs1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6fs1a2