Lineage for d6fd8b1 (6fd8 B:4-90)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368998Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2368999Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2369000Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2369095Protein automated matches [254533] (1 species)
    not a true protein
  7. 2369096Species Human (Homo sapiens) [TaxId:9606] [255181] (4 PDB entries)
  8. 3061586Domain d6fd8b1: 6fd8 B:4-90 [361648]
    automated match to d1zwma1

Details for d6fd8b1

PDB Entry: 6fd8 (more details), 2.1 Å

PDB Description: gamma-s crystallin dimer
PDB Compounds: (B:) Beta-crystallin S

SCOPe Domain Sequences for d6fd8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fd8b1 b.11.1.1 (B:4-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtkitfyedknfqgrrydcdcdcadfhtylsrcnsikveggtwavyerpnfagymyilpq
geypeyqrwmglndrlsscravhlpsg

SCOPe Domain Coordinates for d6fd8b1:

Click to download the PDB-style file with coordinates for d6fd8b1.
(The format of our PDB-style files is described here.)

Timeline for d6fd8b1:

  • d6fd8b1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

View in 3D
Domains from same chain:
(mouse over for more information)
d6fd8b2