![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
![]() | Protein automated matches [190698] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187833] (36 PDB entries) |
![]() | Domain d6drga1: 6drg A:1-127 [361622] Other proteins in same PDB: d6drga2 automated match to d3pp6b_ complexed with 2vn |
PDB Entry: 6drg (more details)
SCOPe Domain Sequences for d6drga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6drga1 b.60.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]} msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf kriskri
Timeline for d6drga1: