Lineage for d6drga1 (6drg A:1-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396500Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2396501Protein automated matches [190698] (22 species)
    not a true protein
  7. 2396530Species Human (Homo sapiens) [TaxId:9606] [187833] (36 PDB entries)
  8. 3061560Domain d6drga1: 6drg A:1-127 [361622]
    Other proteins in same PDB: d6drga2
    automated match to d3pp6b_
    complexed with 2vn

Details for d6drga1

PDB Entry: 6drg (more details)

PDB Description: nmr solution structure of wild type hfabp1 with gw7647
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d6drga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drga1 b.60.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskri

SCOPe Domain Coordinates for d6drga1:

Click to download the PDB-style file with coordinates for d6drga1.
(The format of our PDB-style files is described here.)

Timeline for d6drga1:

  • d6drga1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27

3061560
d6drga1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6drga2