Lineage for d6a63a_ (6a63 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (87 PDB entries)
  8. 3061559Domain d6a63a_: 6a63 A: [361621]
    automated match to d1hdka_
    complexed with lat

Details for d6a63a_

PDB Entry: 6a63 (more details), 1.63 Å

PDB Description: placental protein 13/galectin-13 variant r53hh57r with lactose
PDB Compounds: (A:) Galactoside-binding soluble lectin 13

SCOPe Domain Sequences for d6a63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a63a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvrfgnh
vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
kmvqvsrdisltsvcvcn

SCOPe Domain Coordinates for d6a63a_:

Click to download the PDB-style file with coordinates for d6a63a_.
(The format of our PDB-style files is described here.)

Timeline for d6a63a_:

  • d6a63a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-27