Lineage for d6a0pa2 (6a0p A:300-406)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (64 species)
    not a true protein
  7. 3061548Species Usutu virus [TaxId:64286] [361610] (1 PDB entry)
  8. 3061549Domain d6a0pa2: 6a0p A:300-406 [361611]
    Other proteins in same PDB: d6a0pa1, d6a0pa3
    automated match to d3p54a2

Details for d6a0pa2

PDB Entry: 6a0p (more details), 2 Å

PDB Description: crystal structure of usutu virus envelope protein in the pre-fusion state
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6a0pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a0pa2 b.1.18.0 (A:300-406) automated matches {Usutu virus [TaxId: 64286]}
tygmctekfsfaknpadtghgtvvlelqytgsdgpckipisivaslsdltpigrmvtanp
yvasseanakvlvemeppfgdsyivvgrgdkqinhhwhkagssigka

SCOPe Domain Coordinates for d6a0pa2:

Click to download the PDB-style file with coordinates for d6a0pa2.
(The format of our PDB-style files is described here.)

Timeline for d6a0pa2:

  • d6a0pa2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-27